PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10015369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 324aa    MW: 35822.2 Da    PI: 8.5738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10015369genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      Lus10015369 14 KGPWTPEEDIQLVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.32.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10015369  67 RGNFTDHEEQMIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.795961IPR017930Myb domain
SuperFamilySSF466894.49E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
CDDcd001672.48E-111661No hitNo description
PROSITE profilePS5129424.37662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465116IPR009057Homeodomain-like
SMARTSM007178.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1367112IPR001005SANT/Myb domain
CDDcd001673.93E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRPPCCDKL GVKKGPWTPE EDIQLVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEQMIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLRRKLSMVD  120
QPPQRINGDY NSSSSVNLSP SCSSSTTKAL AAVPKRSKKS TTVPSSRGQW ERRLQTDIHN  180
ARRALSQAIS PPTKAETVPS PEVDVSGSGS VSCSSAAVYA SNAENIARLL KGWGRKQQQQ  240
QPSNANLKNE PAEESMWSEP SQVSSSAYSV VDLPDHHAMD SFLGSDLYSP TLTTPFEGQT  300
VVASDDEVRL SLIEKWLIHV IEA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-26141164105MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-26141164105C-Myb DNA-Binding Domain
1mse_C1e-26141164105C-Myb DNA-Binding Domain
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341011.11e-105PREDICTED: myb-related protein 306-like
SwissprotQ9SCU72e-98MYB30_ARATH; Transcription factor MYB30
TrEMBLV4UX791e-102V4UX79_9R
STRINGPOPTR_0017s11880.15e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.13e-95myb domain protein 30